Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Adenosine Deaminase/ADA Antibody, Novus Biologicals™

Adenosine Deaminase/ADA Antibody, Novus Biologicals™
SDP

Catalog No. NBP187404 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP187404 0.1 mL
NB406080 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP187404 Supplier Novus Biologicals Supplier No. NBP187404
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

Adenosine Deaminase/ADA Polyclonal specifically detects Adenosine Deaminase/ADA in Human, Mouse, Rat samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Adenosine Deaminase/ADA
Applications Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Flow Cytometry Reported in the scientific literature (PMID: 25172498)., Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated Reported in the scientific literature (PMID: 31978345).
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P00813
Gene Alias ADA1, adenine deaminase, Adenosine aminohydrolase, adenosine deaminase, EC 3.5.4.4
Gene Symbols ADA
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE
Molecular Weight of Antigen 41 kDa
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 100
Test Specificity Specificity of human Adenosine Deaminase/ADA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.