Adenylate Cyclase 6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159023

Catalog No. NBP159023

Description

Adenylate Cyclase 6 Polyclonal specifically detects Adenylate Cyclase 6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Adenylate Cyclase 6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AC6, adenylate cyclase 6, adenylate cyclase type 6, Adenylate cyclase type VI, Adenylyl cyclase 6, ATP pyrophosphate-lyase 6, Ca(2+)-inhibitable adenylyl cyclase, DKFZp779F075, EC 4.6.1.1, KIAA0422
• Host Species: Rabbit
• Molecular Weight of Antigen: 125 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism, Vision
• Gene ID (Entrez): 112
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43306
• Gene Symbols: ADCY6
• Immunogen: Synthetic peptides corresponding to ADCY6(adenylate cyclase 6) The peptide sequence was selected from the C terminal of ADCY6 (NP_066193). Peptide sequence LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only