Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159023

Adenylate Cyclase 6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159023 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159023 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159023 Supplier Novus Biologicals Supplier No. NBP159023
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Adenylate Cyclase 6 Polyclonal specifically detects Adenylate Cyclase 6 in Human samples. It is validated for Western Blot.

Specifications

Antigen Adenylate Cyclase 6
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O43306
Gene Alias AC6, adenylate cyclase 6, adenylate cyclase type 6, Adenylate cyclase type VI, Adenylyl cyclase 6, ATP pyrophosphate-lyase 6, Ca(2+)-inhibitable adenylyl cyclase, DKFZp779F075, EC 4.6.1.1, KIAA0422
Gene Symbols ADCY6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ADCY6(adenylate cyclase 6) The peptide sequence was selected from the C terminal of ADCY6 (NP_066193). Peptide sequence LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY.
Molecular Weight of Antigen 125 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Vision
Primary or Secondary Primary
Gene ID (Entrez) 112
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.