Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Adiponutrin/PNPLA3 Antibody, Novus Biologicals™

Adiponutrin/PNPLA3 Antibody, Novus Biologicals™
SDP

Catalog No. NB018478 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.025 mg
0.1 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB018478 0.025 mg
NBP130092 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB018478 Supplier Novus Biologicals Supplier No. NBP1300920.025MG

Description

Goat Polyclonal Antibody

Adiponutrin/PNPLA3 Polyclonal specifically detects Adiponutrin/PNPLA3 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Adiponutrin/PNPLA3
Applications Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1.0 mg/mL
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml, Immunohistochemistry 4ug/ml, Immunohistochemistry-Paraffin 4ug/ml
Formulation PBS with 1 mg/ml BSA with 0.1% Sodium Azide
Gene Alias Acylglycerol O-acyltransferase, adiponutrin, ADPNdJ796I17.1, C22orf20, Calcium-independent phospholipase A2-epsilon, chromosome 22 open reading frame 20, EC 2.3.1.-, EC 2.7.7.56, EC 3.1.1.3, EC 4.2.3.4, FLJ22012, iPLA(2)epsilon, iPLA2-epsilon, patatin-like phospholipase domain containing 3, patatin-like phospholipase domain-containing protein 3
Gene Symbols PNPLA3
Host Species Goat
Immunogen Synthetic peptide (CVRKARSRNIGTLHPFFNINKCIRDGLQESLPD) corresponding to aa 73-104 mouse Adiponutrin 3.
Purification Method Affinity Purified
Quantity 0.025 mg
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 80339
Test Specificity VRKARSRNIGTLHPFFNINKCIRDGLQESLPD 73-104. Mouse Q91WW7
Target Species Mouse
Content And Storage Store at -80C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.