Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Adiponutrin/PNPLA3 Antibody, Novus Biologicals™

Goat Polyclonal Antibody
Supplier: Novus Biologicals NBP130092
Description
Adiponutrin/PNPLA3 Polyclonal specifically detects Adiponutrin/PNPLA3 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Adiponutrin/PNPLA3 | |
Polyclonal | |
Unconjugated | |
PBS with 1 mg/ml BSA with 0.1% Sodium Azide | |
PNPLA3 | |
Synthetic peptide (CVRKARSRNIGTLHPFFNINKCIRDGLQESLPD) corresponding to aa 73-104 mouse Adiponutrin 3. | |
0.1 mg | |
Lipid and Metabolism | |
80339 | |
Mouse | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
1.0 mg/mL | |
Western Blot 1 ug/ml, Immunohistochemistry 4ug/ml, Immunohistochemistry-Paraffin 4ug/ml | |
Acylglycerol O-acyltransferase, adiponutrin, ADPNdJ796I17.1, C22orf20, Calcium-independent phospholipase A2-epsilon, chromosome 22 open reading frame 20, EC 2.3.1.-, EC 2.7.7.56, EC 3.1.1.3, EC 4.2.3.4, FLJ22012, iPLA(2)epsilon, iPLA2-epsilon, patatin-like phospholipase domain containing 3, patatin-like phospholipase domain-containing protein 3 | |
Goat | |
Affinity Purified | |
RUO | |
Primary | |
VRKARSRNIGTLHPFFNINKCIRDGLQESLPD 73-104. Mouse Q91WW7 | |
Store at -80C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction