Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Adiponutrin/PNPLA3 Antibody, Novus Biologicals™
Goat Polyclonal Antibody
$206.50 - $499.50
Specifications
| Antigen | Adiponutrin/PNPLA3 |
|---|---|
| Concentration | 1.0 mg/mL |
| Dilution | Western Blot 1 ug/ml, Immunohistochemistry 4ug/ml, Immunohistochemistry-Paraffin 4ug/ml |
| Applications | Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
Description
Adiponutrin/PNPLA3 Polyclonal specifically detects Adiponutrin/PNPLA3 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Adiponutrin/PNPLA3 | |
| Western Blot 1 ug/ml, Immunohistochemistry 4ug/ml, Immunohistochemistry-Paraffin 4ug/ml | |
| Polyclonal | |
| Goat | |
| Lipid and Metabolism | |
| PBS with 1 mg/ml BSA with 0.1% Sodium Azide | |
| 80339 | |
| Synthetic peptide (CVRKARSRNIGTLHPFFNINKCIRDGLQESLPD) corresponding to aa 73-104 mouse Adiponutrin 3. | |
| Primary | |
| Store at -80C. Avoid freeze-thaw cycles. |
| 1.0 mg/mL | |
| Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Mouse | |
| Acylglycerol O-acyltransferase, adiponutrin, ADPNdJ796I17.1, C22orf20, Calcium-independent phospholipase A2-epsilon, chromosome 22 open reading frame 20, EC 2.3.1.-, EC 2.7.7.56, EC 3.1.1.3, EC 4.2.3.4, FLJ22012, iPLA(2)epsilon, iPLA2-epsilon, patatin-like phospholipase domain containing 3, patatin-like phospholipase domain-containing protein 3 | |
| PNPLA3 | |
| IgG | |
| Affinity Purified | |
| VRKARSRNIGTLHPFFNINKCIRDGLQESLPD 73-104. Mouse Q91WW7 |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title