ADPRM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179668

Catalog No. NBP179668

Description

ADPRM Polyclonal specifically detects ADPRM in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ADPRM
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADPRibase-Mn, ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent, ADPRM, C17orf48, chromosome 17 open reading frame 48, manganese-dependent ADP-ribose/CDP-alcohol diphosphatase, MDS006, NBLA03831
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56985
• Target Species: Human, Equine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_064618
• Gene Symbols: ADPRM
• Immunogen: Synthetic peptide directed towards the N terminal of human C17orf48The immunogen for this antibody is C17ORF48. Peptide sequence MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.