Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ADPRM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ADPRM |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ADPRM Polyclonal specifically detects ADPRM in Human samples. It is validated for Western Blot.Specifications
ADPRM | |
Polyclonal | |
Rabbit | |
NP_064618 | |
56985 | |
Synthetic peptide directed towards the N terminal of human C17orf48The immunogen for this antibody is C17ORF48. Peptide sequence MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ADPRibase-Mn, ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent, ADPRM, C17orf48, chromosome 17 open reading frame 48, manganese-dependent ADP-ribose/CDP-alcohol diphosphatase, MDS006, NBLA03831 | |
ADPRM | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title