Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Advillin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | Advillin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180007
|
Novus Biologicals
NBP180007 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
Advillin Polyclonal specifically detects Advillin in Human samples. It is validated for Western Blot.Specifications
| Advillin | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| ADVIL, advillin, DOC6, FLJ12386, MGC133244, p92DKFZp779O1812 | |
| AVIL | |
| IgG | |
| 60 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O75366 | |
| 10677 | |
| Synthetic peptide directed towards the middle region of human AVIL (NP_006567). Peptide sequence: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title