Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Advillin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | Advillin |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Advillin Polyclonal specifically detects Advillin in Human samples. It is validated for Western Blot.Specifications
Advillin | |
Polyclonal | |
Rabbit | |
Neuroscience | |
ADVIL, advillin, DOC6, FLJ12386, MGC133244, p92DKFZp779O1812 | |
AVIL | |
IgG | |
60 kDa |
Western Blot | |
Unconjugated | |
RUO | |
O75366 | |
10677 | |
Synthetic peptide directed towards the middle region of human AVIL (NP_006567). Peptide sequence: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title