Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16902720UL
Description
AF4 Polyclonal specifically detects AF4 in Mouse samples. It is validated for Western Blot.Specifications
| AF4 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| AF-4, AF4/FMR2 family member 1, AF4/FMR2 family, member 1, AF4myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 2, ALL1-fused gene from chromosome 4 protein, FEL, MLLT2MGC134969, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 2, PBM1, pre-B-cell monocytic leukemia partner 1, Protein AF-4, Protein FEL, Proto-oncogene AF4 | |
| Rabbit | |
| 132 kDa | |
| 20 μL | |
| Primary | |
| Mouse | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| Aff1 | |
| Synthetic peptides corresponding to Aff1 (AF4/FMR2 family, member 1) The peptide sequence was selected from the N terminal of Aff1. Peptide sequence MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG. | |
| Affinity Purified | |
| RUO | |
| 4299 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction