Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AF4 Antibody, Novus Biologicals™

AF4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16902720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16902720 20 μL
NBP169027 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16902720 Supplier Novus Biologicals Supplier No. NBP16902720UL

Description

Rabbit Polyclonal Antibody

AF4 Polyclonal specifically detects AF4 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen AF4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Alias AF-4, AF4/FMR2 family member 1, AF4/FMR2 family, member 1, AF4myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 2, ALL1-fused gene from chromosome 4 protein, FEL, MLLT2MGC134969, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 2, PBM1, pre-B-cell monocytic leukemia partner 1, Protein AF-4, Protein FEL, Proto-oncogene AF4
Gene Symbols Aff1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Aff1 (AF4/FMR2 family, member 1) The peptide sequence was selected from the N terminal of Aff1. Peptide sequence MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG.
Molecular Weight of Antigen 132 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4299
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.