Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AF4 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | AF4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16902720
|
Novus Biologicals
NBP16902720UL |
20 μL |
Each for $152.22
|
|
NBP169027
|
Novus Biologicals
NBP169027 |
100 μL |
Each for $436.00
|
|
Description
AF4 Polyclonal specifically detects AF4 in Mouse samples. It is validated for Western Blot.Specifications
| AF4 | |
| Polyclonal | |
| Rabbit | |
| AF-4, AF4/FMR2 family member 1, AF4/FMR2 family, member 1, AF4myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 2, ALL1-fused gene from chromosome 4 protein, FEL, MLLT2MGC134969, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 2, PBM1, pre-B-cell monocytic leukemia partner 1, Protein AF-4, Protein FEL, Proto-oncogene AF4 | |
| Aff1 | |
| IgG | |
| Affinity Purified | |
| 132 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 4299 | |
| Synthetic peptides corresponding to Aff1 (AF4/FMR2 family, member 1) The peptide sequence was selected from the N terminal of Aff1. Peptide sequence MAAHSSLYNEDRNLLRIREKERRNQEAHQEKEAFPEKAPLFPEPYKTAKG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title