AGAP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB169021	Novus Biologicals NBP31697225UL	25 μg
NB169020	Novus Biologicals NBP316972100UL	100 μg

Description

AGAP2 Polyclonal antibody specifically detects AGAP2 in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: AGAP2
• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Apoptosis
• Formulation: PBS, pH 7.2, 40% glycerol
• Gene ID (Entrez): 116986
• Isotype: IgG
• Purification Method: Affinity purified

• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: AGAP-2, ArfGAP with GTPase domain, ankyrin repeat and PH domain 2, arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2, centaurin, gamma 1, centaurin-gamma-1, CENTG1, Cnt-g1, FLJ16430, GGAP2, GTP-binding and GTPase activating protein 2, GTP-binding and GTPase-activating protein 2, KIAA0167, Phosphatidylinositol-3-kinase enhancer, phosphoinositide 3-kinase enhancer, PIKEArf GAP with GTP-binding protein-like, ANK repeat and PH domains 2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDS
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.