Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AGAP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB169021 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169021 25 μg
NB169020 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB169021 Supplier Novus Biologicals Supplier No. NBP31697225UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

AGAP2 Polyclonal antibody specifically detects AGAP2 in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen AGAP2
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias AGAP-2, ArfGAP with GTPase domain, ankyrin repeat and PH domain 2, arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2, centaurin, gamma 1, centaurin-gamma-1, CENTG1, Cnt-g1, FLJ16430, GGAP2, GTP-binding and GTPase activating protein 2, GTP-binding and GTPase-activating protein 2, KIAA0167, Phosphatidylinositol-3-kinase enhancer, phosphoinositide 3-kinase enhancer, PIKEArf GAP with GTP-binding protein-like, ANK repeat and PH domains 2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: AASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDS
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 116986
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.