AGO1/EIF2C1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317209100UL

Catalog No. NB169494

Description

AGO1/EIF2C1 Polyclonal antibody specifically detects AGO1/EIF2C1 in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: AGO1/EIF2C1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: AGO1Q99, argonaute 1, argonaute1, DKFZp686M13167, EIF2C, eIF2C 1, eIF-2C 1, Eukaryotic translation initiation factor 2C 1, eukaryotic translation initiation factor 2C, 1, GERP95, Golgi Endoplasmic Reticulum protein 95 kDa, hAgo1, protein argonaute-1, Putative RNA-binding protein Q99
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEIS
• Quantity: 100 μg
• Research Discipline: Cell Biology, Cell Cycle and Replication, Immunology
• Gene ID (Entrez): 26523
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified