Ago2/eIF2C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25838225UL

Catalog No. NB393478

Description

Ago2/eIF2C2 Polyclonal specifically detects Ago2/eIF2C2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Ago2/eIF2C2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: AGO2argonaute 2, argonaute2, EC 3.1.26.n1, EC 3.1.26.n2, eIF2C 2, eIF-2C 2, Eukaryotic translation initiation factor 2C 2, eukaryotic translation initiation factor 2C, 2, hAgo2, MGC3183, PAZ Piwi domain protein, PPD, protein argonaute-2, Protein slicer, Q10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: AGO2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IQGYAFKPPPRPDFGTSGRTIKLQANFFEMDI
• Quantity: 25 μL
• Research Discipline: Epigenetics, microRNA
• Gene ID (Entrez): 27161
• Target Species: Human
• Isotype: IgG

For Research Use Only