AGPAT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174276

Catalog No. NBP174276

Description

AGPAT3 Polyclonal specifically detects AGPAT3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AGPAT3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 1-acylglycerol-3-phosphate O-acyltransferase 31-acyl-sn-glycerol-3-phosphate acyltransferase gamma, EC 2.3.1.51, gene similar to plant lysophosphatidic acid acyltransferase10lysophosphatidic acid acyltransferase-gamma1, LPAAT-gamma, LPAAT-GAMMA1, Lysophosphatidic acid acyltransferase gamma, MGC4604,1-AGP acyltransferase 3,1-AGPAT 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 86%; Bovine: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NRZ7
• Gene Symbols: AGPAT3
• Immunogen: Synthetic peptides corresponding to the middle region of AGPAT3 (NP_064517). Immunizing peptide sequence KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56894
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.