Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AGPAT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$499.50

Specifications

Antigen	AGPAT3
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP174276 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP174276	100 μL	Each of 1 for $499.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

AGPAT3 Polyclonal specifically detects AGPAT3 in Human samples. It is validated for Western Blot.

Specifications

Antigen	AGPAT3
Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	1-acylglycerol-3-phosphate O-acyltransferase 31-acyl-sn-glycerol-3-phosphate acyltransferase gamma, EC 2.3.1.51, gene similar to plant lysophosphatidic acid acyltransferase10lysophosphatidic acid acyltransferase-gamma1, LPAAT-gamma, LPAAT-GAMMA1, Lysophosphatidic acid acyltransferase gamma, MGC4604,1-AGP acyltransferase 3,1-AGPAT 3
Gene Symbols	AGPAT3
Isotype	IgG
Molecular Weight of Antigen	43 kDa

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9NRZ7
Gene ID (Entrez)	56894
Immunogen	Synthetic peptides corresponding to the middle region of AGPAT3 (NP_064517). Immunizing peptide sequence KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

AGPAT3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents