Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Agpat4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179870 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179870 100 μL
NBP17987020 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP179870 Supplier Novus Biologicals Supplier No. NBP179870
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Agpat4 Polyclonal specifically detects Agpat4 in Human samples. It is validated for Western Blot.

Specifications

Antigen Agpat4
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NRZ5
Gene Alias 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acidacyltransferase, delta), 1-AGP acyltransferase 4,1-acylglycerol-3-phosphate O-acyltransferase 4,1-AGPAT 4, dJ473J16.2,1-acyl-sn-glycerol-3-phosphate acyltransferase delta, EC 2.3.1.51, LPAAT-delta1-AGPAT4, Lysophosphatidic acid acyltransferase delta, lysophosphatidic acid acyltransferase-delta (LPAAT-delta)
Gene Symbols AGPAT4
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human AGPAT4The immunogen for this antibody is AGPAT4 (NP_064518). Peptide Sequence: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM
Molecular Weight of Antigen 44 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56895
Test Specificity Expected identity based on immunogen sequence: Dog: 85%; Rat: 85%; Mouse: 85%; Guinea pig: 85%.
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.