Agpat4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP17987020UL

Catalog No. NBP17987020

Description

Agpat4 Polyclonal specifically detects Agpat4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Agpat4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NRZ5
• Gene Symbols: AGPAT4
• Immunogen: Synthetic peptide directed towards the middle region of human AGPAT4The immunogen for this antibody is AGPAT4 (NP_064518). Peptide Sequence: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56895
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acidacyltransferase, delta), 1-AGP acyltransferase 4,1-acylglycerol-3-phosphate O-acyltransferase 4,1-AGPAT 4, dJ473J16.2,1-acyl-sn-glycerol-3-phosphate acyltransferase delta, EC 2.3.1.51, LPAAT-delta1-AGPAT4, Lysophosphatidic acid acyltransferase delta, lysophosphatidic acid acyltransferase-delta (LPAAT-delta)
• Host Species: Rabbit
• Molecular Weight of Antigen: 44 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG