Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AGTPBP1 Antibody, Novus Biologicals™

AGTPBP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179579 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179579 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179579 Supplier Novus Biologicals Supplier No. NBP179579
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

AGTPBP1 Polyclonal specifically detects AGTPBP1 in Human samples. It is validated for Western Blot.

Specifications

Antigen AGTPBP1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UPW5
Gene Alias ATP/GTP binding protein 1, ATP/GTP-binding protein 1, CCP1, DKFZp686M20191, EC 3.4.17, EC 3.4.17.-, KIAA1035NNA1cytosolic carboxypeptidase 1, Nervous system nuclear protein induced by axotomy protein 1 homolog, Nna1
Gene Symbols AGTPBP1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human AGTPBP1The immunogen for this antibody is AGTPBP1 (NP_056054). Peptide Sequence: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI
Molecular Weight of Antigen 134 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23287
Test Specificity Expected identity based on immunogen sequence: Zebrafish: 86%.
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.