AGTPBP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179579

Catalog No. NBP179579

Description

AGTPBP1 Polyclonal specifically detects AGTPBP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AGTPBP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP/GTP binding protein 1, ATP/GTP-binding protein 1, CCP1, DKFZp686M20191, EC 3.4.17, EC 3.4.17.-, KIAA1035NNA1cytosolic carboxypeptidase 1, Nervous system nuclear protein induced by axotomy protein 1 homolog, Nna1
• Host Species: Rabbit
• Molecular Weight of Antigen: 134 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UPW5
• Gene Symbols: AGTPBP1
• Immunogen: Synthetic peptide directed towards the N terminal of human AGTPBP1The immunogen for this antibody is AGTPBP1 (NP_056054). Peptide Sequence: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23287
• Reconstitution: Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.