AGXT2L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25738625UL

Catalog No. NB393993

Description

AGXT2L2 Polyclonal specifically detects AGXT2L2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: AGXT2L2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: alanine--glyoxylate aminotransferase 2-like 2, alanine-glyoxylate aminotransferase 2-like 2, EC 2.6.1, EC 2.6.1.-, EC 2.6.1.11, EC 2.6.1.13, EC 2.6.1.44, MGC117348, MGC15875, MGC45484
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 85007
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AGXT2L2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only