AHCYL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP183093

Catalog No. NBP183093

Description

AHCYL1 Polyclonal specifically detects AHCYL1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: AHCYL1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated
• Gene Alias: adenosylhomocysteinase-like 1, AdoHcyase 2, DCAL, DC-expressed AHCY-like molecule, dendritic cell expressed AHCY-like protein, inositol 14,5-trisphosphate receptor-binding protein, IRBIT, PRO0233, putative adenosylhomocysteinase 2, S-adenosyl homocysteine hydrolase homolog, S-adenosylhomocysteine hydrolase-like 1, S-adenosylhomocysteine hydrolase-like protein 1, S-adenosyl-L-homocysteine hydrolase 2, XPVKONAEC 3.3.1.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10768
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: AHCYL1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only