Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AHRR Rabbit anti-Human, Polyclonal, Novus Biologicals™

AHRR Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB125918 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125918 25 μg
NB125917 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB125918 Supplier Novus Biologicals Supplier No. NBP31050825UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

AHRR Polyclonal specifically detects AHRR in Human samples. It is validated for Western Blot.

Specifications

Antigen AHRR
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias AHH, AHHR, AhR repressor, AhRR, aryl hydrocarbon receptor regulator, aryl hydrocarbon receptor repressor, arylhydrocarbon receptor repressor, aryl-hydrocarbon receptor repressor, BHLHE77, Class E basic helix-loop-helix protein 77, dioxin receptor repressor, KIAA1234bHLHe77aryl hydrocarbon hydroxylase regulator, MGC167813, MGC176630
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AHRR (NP_065782). Peptide sequence LPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVP
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57491
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.