Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16254520UL

Catalog No. NBP16254520

Description

Airway Trypsin-like Protease/HAT/TMPRSS11D Polyclonal specifically detects Airway Trypsin-like Protease/HAT/TMPRSS11D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Airway Trypsin-like Protease/HAT/TMPRSS11D
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: O60235
• Gene Symbols: TMPRSS11D
• Immunogen: Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the N terminal of TMPRSS11D. Peptide sequence RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9407
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: airway trypsin like protease, Airway trypsin-like protease, EC 3.4.21, EC 3.4.21.-, HAT, MGC150587, MGC150588, transmembrane protease serine 11D, transmembrane protease, serine 11D
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified