Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody, Novus Biologicals™

Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody, Novus Biologicals™
SDP

Catalog No. NBP16254520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16254520 20 μL
NBP162545 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16254520 Supplier Novus Biologicals Supplier No. NBP16254520UL

Description

Rabbit Polyclonal Antibody

Airway Trypsin-like Protease/HAT/TMPRSS11D Polyclonal specifically detects Airway Trypsin-like Protease/HAT/TMPRSS11D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Airway Trypsin-like Protease/HAT/TMPRSS11D
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O60235
Gene Alias airway trypsin like protease, Airway trypsin-like protease, EC 3.4.21, EC 3.4.21.-, HAT, MGC150587, MGC150588, transmembrane protease serine 11D, transmembrane protease, serine 11D
Gene Symbols TMPRSS11D
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the N terminal of TMPRSS11D. Peptide sequence RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA.
Molecular Weight of Antigen 46 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9407
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.