Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Airway Trypsin-like Protease/HAT/TMPRSS11D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00
Specifications
Antigen | Airway Trypsin-like Protease/HAT/TMPRSS11D |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16254520
![]() |
Novus Biologicals
NBP16254520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP162545
![]() |
Novus Biologicals
NBP162545 |
100 μL | Item Discontinued This item has been discontinued by the supplier. Please Sign In to view product availability in your area. | N/A | |||||
Description
Airway Trypsin-like Protease/HAT/TMPRSS11D Polyclonal specifically detects Airway Trypsin-like Protease/HAT/TMPRSS11D in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Airway Trypsin-like Protease/HAT/TMPRSS11D | |
Polyclonal | |
Purified | |
RUO | |
airway trypsin like protease, Airway trypsin-like protease, EC 3.4.21, EC 3.4.21.-, HAT, MGC150587, MGC150588, transmembrane protease serine 11D, transmembrane protease, serine 11D | |
TMPRSS11D | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
O60235 | |
9407 | |
Synthetic peptides corresponding to TMPRSS11D(transmembrane protease, serine 11D) The peptide sequence was selected from the N terminal of TMPRSS11D. Peptide sequence RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA. | |
Primary | |
46 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title