AK3L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP247553

Catalog No. NBP247553

Description

AK3L1 Polyclonal specifically detects AK3L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AK3L1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: adenylate kinase 3, Adenylate kinase 3-like, adenylate kinase 3-like 1, adenylate kinase 4, AK3adenylate kinase isoenzyme 4, mitochondrial, AK3L1, AK3L2, ATP-AMP transphosphorylase, EC 2.7.4, EC 2.7.4.3, GTP:AMP phosphotransferase, MGC166959, mitochondrial adenylate kinase-3, nucleoside-triphosphate-adenylate kinase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: AK4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PEAVAARLRQYKDVAKPVIELYKSRGVLHQF
• Quantity: 0.1 mL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 205
• Target Species: Human
• Isotype: IgG

For Research Use Only