Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AK3L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | AK3L1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AK3L1 Polyclonal specifically detects AK3L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| AK3L1 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 205 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PEAVAARLRQYKDVAKPVIELYKSRGVLHQF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| adenylate kinase 3, Adenylate kinase 3-like, adenylate kinase 3-like 1, adenylate kinase 4, AK3adenylate kinase isoenzyme 4, mitochondrial, AK3L1, AK3L2, ATP-AMP transphosphorylase, EC 2.7.4, EC 2.7.4.3, GTP:AMP phosphotransferase, MGC166959, mitochondrial adenylate kinase-3, nucleoside-triphosphate-adenylate kinase | |
| AK4 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title