Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301182

AKAP3 Antibody, Novus Biologicals™
SDP

Catalog No. NB301182 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301182 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301182 Supplier Novus Biologicals Supplier No. NBP325270
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

AKAP3 Polyclonal antibody specifically detects AKAP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen AKAP3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias A kinase (PRKA) anchor protein 3, AKAP110AKAP 110, AKAP-3, A-kinase anchor protein 110 kDa, Cancer/testis antigen 82, CT82A-kinase anchor protein 3, Fibrous sheath protein of 95 kDa, fibrousheathin 1, Fibrousheathin I, Fibrousheathin-1, FSP95A-kinase anchor protein, 110kDa, PRKA3, protein kinase A anchoring protein 3, Protein kinase A-anchoring protein 3, SOB1fibrous sheath protein, 95kDa, Sperm oocyte-binding protein, sperm oocyte-binding protein 1
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein AKAP3 using the following amino acid sequence: FSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNVNFAMKSETKLREKMYSEPKSEEETCAKTLGEH
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 10566
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.