Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP180308

AKAP9 Antibody, Novus Biologicals™
SDP

Catalog No. NBP180308 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180308 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP180308 Supplier Novus Biologicals Supplier No. NBP180308
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

AKAP9 Polyclonal specifically detects AKAP9 in Human samples. It is validated for Western Blot.

Specifications

Antigen AKAP9
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. AAH15533
Gene Alias A kinase (PRKA) anchor protein (yotiao) 9, AKAP 350, AKAP 450, AKAP350A-kinase anchor protein 450 kDa, AKAP450A-kinase anchor protein 350 kDa, AKAP-9, Centrosome- and Golgi-localized PKN-associated protein, CG-NAPAKAP 120-like protein, hgAKAP 350, HYPERION, KIAA0803A-kinase anchor protein 9, MU-RMS-40.16A, PRKA9AKAP9-BRAF fusion protein, Protein hyperion, protein kinase A anchoring protein 9, Protein kinase A-anchoring protein 9, Protein yotiao, YOTIAOkinase N-associated protein
Gene Symbols AKAP9
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human AKAP9. Peptide sequence MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVS.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10142
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 92%; Chicken: 91%; Mouse: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.