Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AKR1C2 Antibody, Novus Biologicals™

AKR1C2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157770 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157770 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157770 Supplier Novus Biologicals Supplier No. NBP157770
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

AKR1C2 Polyclonal specifically detects AKR1C2 in Human samples. It is validated for Western Blot.

Specifications

Antigen AKR1C2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P52895
Gene Alias aldo-keto reductase family 1 member C2, aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acidbinding protein; 3-alpha hydroxysteroid dehydrogenase, type III), BABP, Chlordecone reductase homolog HAKRD, DD, DD-2, DD2DD/BABP, DDH2FLJ53800, Dihydrodiol dehydrogenase 2, Dihydrodiol dehydrogenase/bile acid-binding protein, EC 1.1.1,3-alpha-HSD3, EC 1.1.1.213, EC 1.3.1.20, HAKRDAKR1C-pseudo, HBAB, MCDR2, pseudo-chlordecone reductase, Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase, type II dihydrodiol dehydrogenase, Type III 3-alpha-hydroxysteroid dehydrogenase
Gene Symbols AKR1C2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human AKR1C2. Peptide sequence: DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1646
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.