AKR1CL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255163

Catalog No. NBP255163

Description

AKR1CL2 Polyclonal specifically detects AKR1CL2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: AKR1CL2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: AF reductase, AKR1CL2, AKRDC1, Aldo-keto reductase family 1 member C-like protein 21,5-anhydro-D-fructose reductase, Aldo-keto reductase family 1 member E2, aldo-keto reductase family 1, member C-like 2, aldo-keto reductase family 1, member E2, aldo-keto reductase loopADR, aldo-keto reductase related protein, EC 1.1.1, EC 1.1.1.263, hTSP, LoopADR, MGC10612, Testis-specific protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83592
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AKR1E2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQI
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only