Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AKR1CL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | AKR1CL2 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
AKR1CL2 Polyclonal specifically detects AKR1CL2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
AKR1CL2 | |
Polyclonal | |
Rabbit | |
Human | |
AF reductase, AKR1CL2, AKRDC1, Aldo-keto reductase family 1 member C-like protein 21,5-anhydro-D-fructose reductase, Aldo-keto reductase family 1 member E2, aldo-keto reductase family 1, member C-like 2, aldo-keto reductase family 1, member E2, aldo-keto reductase loopADR, aldo-keto reductase related protein, EC 1.1.1, EC 1.1.1.263, hTSP, LoopADR, MGC10612, Testis-specific protein | |
AKR1E2 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
83592 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title