Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AKR1D1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP174082 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP174082 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP174082 Supplier Novus Biologicals Supplier No. NBP174082
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

AKR1D1 Polyclonal specifically detects AKR1D1 in Human samples. It is validated for Western Blot.

Specifications

Antigen AKR1D1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P51857
Gene Alias 3o5bred, Aldo-keto reductase family 1 member D1,3-oxo-5-beta-steroid 4-dehydrogenase, aldo-keto reductase family 1, member D1 (delta4-3-ketosteroid-5-beta-reductase), CBAS2, Delta(4)-3-oxosteroid 5-beta-reductase, EC 1.3.1.3, SRD5B1beta polypeptide 1 (3-oxo-5 beta-steroid delta4-dehydrogenase beta 1)
Gene Symbols AKR1D1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the middle region of AKR1D1 (NP_005980). Peptide Sequence: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL
Molecular Weight of Antigen 37 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 6718
Test Specificity Expected identity based on immunogen sequence: Chicken: 85%; Pig: 86%; Bovine: 86%; Rat: 77%.
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.