AKR7A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156768

Catalog No. NBP156768

Description

AKR7A3 Polyclonal specifically detects AKR7A3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AKR7A3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AFAR2, AFB1 aldehyde reductase 2, AFB1-AR 2, aflatoxin B1 aldehyde reductase 2, aflatoxin B1 aldehyde reductase member 3, aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22977
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O95154
• Gene Symbols: AKR7A3
• Immunogen: Synthetic peptides corresponding to AKR7A3(aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase)) The peptide sequence was selected from the middle region of AKR7A3. Peptide sequence VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 92%; Bovine: 85%; Equine: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG