Learn More
Specifications
Specifications
| Host Species | Human |
| Components | Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| For Use With (Application) | Inhibition of Akt kinase activity |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Quantity | 2 mg |
| Product Type | AKT1/2/3 Inhibitor Peptide Set |
| Molecular Weight (g/mol) | 4214 |
| Inhibitors | AKT1/2/3 |
| Form | Lyophilized |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
