Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set
Shop All R&D Systems Products

Click to view available options
Quantity:
2 mg
5 mg
Specifications
Specifications
| Host Species | Human |
| Components | Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| For Use With (Application) | Inhibition of Akt kinase activity |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Quantity | 2 mg |
| Product Type | AKT1/2/3 Inhibitor Peptide Set |
| Molecular Weight (g/mol) | 4214 |
| Inhibitors | AKT1/2/3 |
| Form | Lyophilized |
For Research Use Only
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction