Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set
For use in research applications
$572.50 - $1244.00
Specifications
| Host Species | Human |
|---|---|
| Components | Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| For Use With (Application) | Inhibition of Akt kinase activity |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Product Type | AKT1/2/3 Inhibitor Peptide Set |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP229332
|
Novus Biologicals™
NBP229332 |
2 mg |
Each for $572.50
|
|
|||||
|
NBP2293325
|
Novus Biologicals™
NBP2293325MG |
5 mg |
Each for $1,244.00
|
|
|||||
Specifications
| Human | |
| Inhibition of Akt kinase activity | |
| AKT1/2/3 Inhibitor Peptide Set | |
| AKT1/2/3 |
| Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| 4214 | |
| Lyophilized |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title