Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Alanyl tRNA synthetase Antibody, Novus Biologicals™

Alanyl tRNA synthetase Antibody, Novus Biologicals™
SDP

Catalog No. NBP15713620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15713620 20 μL
NBP157136 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15713620 Supplier Novus Biologicals Supplier No. NBP15713620UL

Description

Rabbit Polyclonal Antibody

Alanyl tRNA synthetase Polyclonal specifically detects Alanyl tRNA synthetase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Alanyl tRNA synthetase
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P49588
Gene Alias alanine tRNA ligase 1, cytoplasmic, Alanine--tRNA ligase, alanyl-tRNA synthetase, alanyl-tRNA synthetase, cytoplasmic, AlaRS, CMT2N, EC 6.1.1, EC 6.1.1.7, Renal carcinoma antigen NY-REN-42
Gene Symbols AARS
Host Species Rabbit
Immunogen Synthetic peptides corresponding to AARS(alanyl-tRNA synthetase) The peptide sequence was selected from the C terminal of AARS. Peptide sequence VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 16
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.