Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

alcohol dehydrogenase 7 Antibody, Novus Biologicals™
SDP

Catalog No. NB430457 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB430457 25 μL
NBP190232 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB430457 Supplier Novus Biologicals Supplier No. NBP19023225UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

alcohol dehydrogenase 7 Polyclonal specifically detects alcohol dehydrogenase 7 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen alcohol dehydrogenase 7
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ADH4, ADH-4, alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide, alcohol dehydrogenase class 4 mu/sigma chain, Alcohol dehydrogenase class IV mu/sigma chain, alcohol dehydrogenase VII, alcohol dehydrogenase-7, class IV sigma-1 alcohol dehydrogenase, class IV sigmasigma alcohol dehydrogenase, EC 1.1.1, EC 1.1.1.1, Gastric alcohol dehydrogenase, Retinol dehydrogenase
Gene Symbols ADH7
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 131
Test Specificity Specificity of human alcohol dehydrogenase 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.