Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Aldehyde Dehydrogenase 3-A1/ALDH3A1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Aldehyde Dehydrogenase 3-A1/ALDH3A1 Polyclonal specifically detects Aldehyde Dehydrogenase 3-A1/ALDH3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Aldehyde Dehydrogenase 3-A1/ALDH3A1 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 218 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Aldehyde dehydrogenase 3, aldehyde dehydrogenase 3 family, member A1, Aldehyde dehydrogenase family 3 member A1, aldehyde dehydrogenase isozyme 3, aldehyde dehydrogenase type III, ALDH3aldehyde dehydrogenase, dimeric NADP-preferring, ALDHIII, EC 1.2.1, EC 1.2.1.5, MGC10406, stomach aldehyde dehydrogenase | |
| ALDH3A1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title