Aldehyde dehydrogenase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317798100UL

Catalog No. NB159626

Description

Aldehyde dehydrogenase 5 Polyclonal antibody specifically detects Aldehyde dehydrogenase 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Aldehyde dehydrogenase 5
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: aldehyde dehydrogenase 1 family, member B1, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH class 2, ALDH5aldehyde dehydrogenase X, mitochondrial, ALDHXacetaldehyde dehydrogenase 5, EC 1.2.1, EC 1.2.1.3, MGC2230, mitochondrial aldehyde dehydrogenase X
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK
• Quantity: 100 μg
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 219
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified