Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Aldehyde dehydrogenase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Aldehyde dehydrogenase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB159627 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB159627 25 μg
NB159626 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB159627 Supplier Novus Biologicals Supplier No. NBP31779825UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Aldehyde dehydrogenase 5 Polyclonal antibody specifically detects Aldehyde dehydrogenase 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen Aldehyde dehydrogenase 5
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias aldehyde dehydrogenase 1 family, member B1, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH class 2, ALDH5aldehyde dehydrogenase X, mitochondrial, ALDHXacetaldehyde dehydrogenase 5, EC 1.2.1, EC 1.2.1.3, MGC2230, mitochondrial aldehyde dehydrogenase X
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 219
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.