ALDH1A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP19165725UL

Catalog No. NB405419

Description

ALDH1A3 Polyclonal specifically detects ALDH1A3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: ALDH1A3
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20-1:50, Immunohistochemistry-Frozen
• Gene Accession No.: P47895
• Gene Symbols: ALDH1A3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: aldehyde dehydrogenase 1 family, member A3, Aldehyde dehydrogenase 6, aldehyde dehydrogenase family 1 member A3, ALDH1A6, ALDH6acetaldehyde dehydrogenase 6, EC 1.2.1, EC 1.2.1.5, RalDH3, RALDH-3, Retinaldehyde dehydrogenase 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 25 μL
• Research Discipline: Vision
• Gene ID (Entrez): 220
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only