Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALDH1A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP191657
Description
ALDH1A3 Polyclonal specifically detects ALDH1A3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
ALDH1A3 | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50, Immunohistochemistry-Frozen | |
P47895 | |
ALDH1A3 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
aldehyde dehydrogenase 1 family, member A3, Aldehyde dehydrogenase 6, aldehyde dehydrogenase family 1 member A3, ALDH1A6, ALDH6acetaldehyde dehydrogenase 6, EC 1.2.1, EC 1.2.1.5, RalDH3, RALDH-3, Retinaldehyde dehydrogenase 3 | |
Rabbit | |
56 kDa | |
0.1 mL | |
Vision | |
220 | |
Human, Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction