ALDH1L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189414

Catalog No. NBP189414

Description

ALDH1L1 Polyclonal specifically detects ALDH1L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ALDH1L1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: O75891
• Gene Symbols: ALDH1L1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDF
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10840
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 10-formyltetrahydrofolate dehydrogenase, aldehyde dehydrogenase 1 family, member L1, aldehyde dehydrogenase family 1 member L1, Cytosolic 10-formyltetrahydrofolate dehydrogenase, DKFZp781N0997, EC 1.5.1.6,10-FTHFDH, FDH, formyltetrahydrofolate dehydrogenase, FTHFD10-fTHF
• Host Species: Rabbit
• Molecular Weight of Antigen: 99 kDa
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only