ALDH6A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182637

Catalog No. NBP182637

Description

ALDH6A1 Polyclonal specifically detects ALDH6A1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ALDH6A1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: aldehyde dehydrogenase 6 family, member A1, Aldehyde dehydrogenase family 6 member A1, EC 1.2.1.18, EC 1.2.1.27, malonate-semialdehyde dehydrogenase, Malonate-semialdehyde dehydrogenase [acylating], methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial, MGC40271, MMSADHA, MMSDHmitochondrial acylating methylmalonate-semialdehyde dehydrogenase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ALDH6A1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSIT
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 4329
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only