Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ALG8 Antibody, Novus Biologicals™

ALG8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169028 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169028 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169028 Supplier Novus Biologicals Supplier No. NBP169028
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ALG8 Polyclonal specifically detects ALG8 in Rat samples. It is validated for Western Blot.

Specifications

Antigen ALG8
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q497D1
Gene Alias alpha-1,3-glucosyltransferase), asparagine-linked glycosylation 8 homolog (S. cerevisiae, asparagine-linked glycosylation 8 homolog (yeast, asparagine-linked glycosylation 8, alpha-1,3-glucosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 8 homolog, CDG1H, dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase, dolichyl-P-glucose:Glc1Man9GlcNAc2-PP-dolichyl-alpha-1,3-glucosyltransferase, EC 2.4.1, EC 2.4.1.-, HUSSY-02, MGC2840, probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
Gene Symbols ALG8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Alg8 (asparagine-linked glycosylation 8, alpha-1,3-glucosyltransferase homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of Alg8 (NP_001029299). Peptide sequence: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 59 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79053
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.