Learn More
Alkaline Phosphatase/ALPL Rabbit anti-Human, Mouse, Rat, Clone: 10B1M5, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | Alkaline Phosphatase/ALPL |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 10B1M5 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Alkaline phosphatase liver/bone/kidney isozyme, alkaline phosphatase, liver/bone/kidney, alkaline phosphatase, tissue-nonspecific isozyme, alkaline phosphomonoesterase, APTNAP, AP-TNAP, EC 3.1.3.1, FLJ40094, FLJ93059, glycerophosphatase, HOPS, liver/bone/kidney-type alkaline phosphatase, MGC161443, tissue-nonspecific ALP, TNAP, TNSALPMGC167935 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alkaline Phosphatase/ALPL (ALPL) (P05186). MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKT |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.