Alkaline Phosphatase, Intestinal Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP234057

Catalog No. NBP234057

Description

Alkaline Phosphatase, Intestinal Polyclonal specifically detects Alkaline Phosphatase, Intestinal in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Alkaline Phosphatase, Intestinal
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P09923
• Gene Symbols: ALPI
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVE
• Quantity: 0.1 mL
• Research Discipline: Cancer, Embryonic Stem Cell Markers, Lipid and Metabolism, Protein Phosphatase, Stem Cell Markers
• Gene ID (Entrez): 248
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: alkaline phosphatase, intestinal, alkaline phosphomonoesterase, EC 3.1.3.1, glycerophosphatase, IAP, Intestinal alkaline phosphatase, intestinal-type alkaline phosphatase, Kasahara isozyme
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only