ALKBH6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257047

Catalog No. NBP257047

Description

ALKBH6 Polyclonal specifically detects ALKBH6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ALKBH6
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ABH6, AlkB Homolog 6, AlkB, Alkylation Repair Homolog 6, AlkB, Alkylation Repair Homolog 6 (E. Coli), Alkylated DNA Repair Protein AlkB Homolog 6, Alkylation Repair Homolog 6, Alpha-Ketoglutarate-Dependent Dioxygenase AlkB Homolog 6, EC 1.14.11, Probable Alpha-Ketoglutarate-Dependent Dioxygenase ABH6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84964
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ALKBH6
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only