ALKBH7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23845025UL

Catalog No. NB404660

Description

ALKBH7 Polyclonal specifically detects ALKBH7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ALKBH7
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9BT30
• Gene Symbols: ALKBH7
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAIHGFRETEKSRWSEASRAILQRV
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ABH7SPATA11, alkB, alkylation repair homolog 7 (E. coli), Alkylated DNA repair protein alkB homolog 7, EC 1.14.11.-, MGC10974, probable alpha-ketoglutarate-dependent dioxygenase ABH7, spermatogenesis associated 11, spermatogenesis cell proliferation related protein, Spermatogenesis cell proliferation-related protein, Spermatogenesis-associated protein 11, UNQ6002
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84266
• Target Species: Human
• Isotype: IgG