Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALKBH7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	ALKBH7
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB404660 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23845025UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP238450 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP238450	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ALKBH7 Polyclonal specifically detects ALKBH7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	ALKBH7
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q9BT30
Gene ID (Entrez)	84266
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: SGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAIHGFRETEKSRWSEASRAILQRV
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	ABH7SPATA11, alkB, alkylation repair homolog 7 (E. coli), Alkylated DNA repair protein alkB homolog 7, EC 1.14.11.-, MGC10974, probable alpha-ketoglutarate-dependent dioxygenase ABH7, spermatogenesis associated 11, spermatogenesis cell proliferation related protein, Spermatogenesis cell proliferation-related protein, Spermatogenesis-associated protein 11, UNQ6002
Gene Symbols	ALKBH7
Isotype	IgG
Purification Method	Affinity Purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ALKBH7 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents